PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G328000.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family WRKY
Protein Properties Length: 268aa    MW: 30705.7 Da    PI: 9.0402
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G328000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.31.4e-32187245159
                         ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                         ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r ++d+ vv++tYeg H+h+
  Potri.001G328000.1 187 LDDGYRWRKYGQKAVKNNKFPRSYYRCTYQGCNVKKQVQRLTKDEGVVVTTYEGMHTHP 245
                         59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.1E-33172245IPR003657WRKY domain
SuperFamilySSF1182901.44E-29179246IPR003657WRKY domain
PROSITE profilePS5081129.895182247IPR003657WRKY domain
SMARTSM007743.5E-39187246IPR003657WRKY domain
PfamPF031061.6E-26188245IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MLASYLKNLP TKPMLEDDPL DSNWPFNHDM DDRRVSFENL EYLYTTKPPL PFIYCVCSLP  60
LETFPFSFFR SSSSFIRAGF SMEKFQMLFP FSSTGSPNYP VSSSMTNSSH VFHNFQADSS  120
GGFLGLKTET QHPVPRTSPE INKDLNSQSA SCAIGSETEP QAAKKKGEKK IRKPKYAFQT  180
RSQVDILDDG YRWRKYGQKA VKNNKFPRSY YRCTYQGCNV KKQVQRLTKD EGVVVTTYEG  240
MHTHPIEKPN DNFEHILSQM QIYSTPF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A6e-26179246976Probable WRKY transcription factor 4
1wj2_A6e-26179246976Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002300120.21e-138hypothetical protein POPTR_0001s33560g
TrEMBLB9GF441e-138B9GF44_POPTR; Uncharacterized protein
STRINGPOPTR_0001s33560.11e-137(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF115634110
Representative plantOGRP1417875
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.11e-56WRKY DNA-binding protein 75